settings Currency keyboard_arrow_down
GBPAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
menu
phoneemailaudreybowlingart@gmail.com
shopping_cart Basket (0)
location_on
Verre du Vin 1
Verre du Vin 1
Verre du Vin 1
Product Code:  4D6hFtY
Product Description
Verre du Vin 1 is an original mixed-media abstract artwork by Audrey Bowling. A Chine Collé print over an exisiting collagraph background featuring a still life of various shapes of glasses.
Size unframed but mounted is H59 x W28.5cm
Artwork aperture is H29 x W14cm
£60.00 inc. tax
Units in Stock 1
Add to Cart Quantity
Product Details
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Product Description
No Reviews Posted Yet - be the first! write review
Featured Products
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Hosted online store
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
10+ years
650k stores created
No card required
Easy to create
What's the catch?
No catch
0% commission
Free forever!
Feature upgrades available
Get Started
i