settings Currency keyboard_arrow_down
GBPAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
menu
phoneemailaudreybowlingart@gmail.com
shopping_cart Basket (0)
location_on
Abstract collage art cards
Abstract collage art cards Abstract collage art cards Abstract collage art cards Abstract collage art cards

Abstract collage art cards

Product Code:  KdwQ2Ok
Product Description
A choice of 3 A6 cards/notelets featuring an original, abstract, mixed-media artwork by Audrey Bowling. Each card is left blank for your own message.
£3.50 inc. tax
Units in Stock 1
Add to Cart Quantity
Product Details
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Product Description
No Reviews Posted Yet - be the first! write review
Featured Products
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Hosted online store
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
10+ years
650k stores created
No card required
Easy to create
What's the catch?
No catch
0% commission
Free forever!
Feature upgrades available
Get Started
i